- Protein: Giant hemoglobin B1b globin chain
- Organism: Beard worm (Oligobrachia mashikoi)
- Length: 145
- Sequence:
ECCSRGDAEVVISEWDQVFNAAMAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGDSSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHIDAWGYCMAYIAAGIGAGL
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-1 |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-2 |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-3 |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-4 |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-5 |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-1 |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-2 |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-3 |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-4 |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-5 |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-1 |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-2 |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-3 |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-4 |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L-5 |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-1 |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-2 |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-3 |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-4 |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-145), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | K-5 |
| Available structure | PDB |