Danish
Uniprot ID:  B3DUZ1
  • Protein: Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain
  • Organism: Methylokorus infernorum (strain V4) (Methylacidiphilum infernorum (isolate V4))
  • Length: 274
  • Sequence:
    • MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDVEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIEEHKKIQSFEYLIRYLEQELSEVINSVIAAFPEIVGIAISTTQGATVSRCSSESYSNIIGSVVSSTLGHAQRLCEAAAAGRLEEIKITGSMLHLYIRQAGSDAAIGVLYPSQTAEGIISLLIRSAALKIQSLLSSFRLKEVNPG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003wfw , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-138 (1-133), 0.50
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E270H, V271H, N272H, P273H, G274H
Insertions None
Deletions K134-K269
Sequence identity to UniProt 0.9638
auth_asym_id A
label_asym_ids of heme B-1 ,  B
Available structure PDB
PDB ID:  pdb_00003wfw , Chain A-1 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-138 (1-133), 0.50
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E270H, V271H, N272H, P273H, G274H
Insertions None
Deletions K134-K269
Sequence identity to UniProt 0.9638
auth_asym_id A
label_asym_ids of heme B-1 ,  B
Available structure PDB
PDB ID:  pdb_00003wfx , Chain A 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 1-136 (1-133), 0.50
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E270H, V271H, N272H, P273H, G274H
Insertions None
Deletions K134-K269
Sequence identity to UniProt 0.9638
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003wfx , Chain B 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 1-135 (1-133), 0.50
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) E270H, V271H, N272H, P273H, G274H
Insertions None
Deletions K134-K269
Sequence identity to UniProt 0.9638
auth_asym_id B
label_asym_ids of heme I
Available structure PDB