Danish
Uniprot ID:  B3FQS5
  • Protein: Cytochrome c
  • Organism: Rhodothermus obamensis (Rhodothermus marinus)
  • Length: 152
  • Sequence:
    • MLLLSLTLAACGGGSSSSTPQPSGSAAQTESGTAAQDPEALAAEIGPVKQVSLGEQIDAALAQQGEQLFNTYCTACHRLDERFIGPALRDVTKRRGPVYIMNVMLNPNGMIQRHPVMKQLVQEYGTMMTDMALSEEQARAILEYLRQVAENQ
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00003cp5 , Chain A 
Resolution 1.24 Å
Residue indices (Uniprot), coverage 9-124 (29-152), 0.82
Mutations (UniProt numbering) None
Insertions None
Deletions M1-Q28
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006cun , Chain A 
Resolution 1.29 Å
Residue indices (Uniprot), coverage 9-123 (36-152), 0.81
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) E30H, S31H, G32H, T33H, A34H, A35H, V103T, M128D, M131E
Insertions None
Deletions M1-T29
Sequence identity to UniProt 0.9268
auth_asym_id A
Missing residues 100ASP-102ASP
Structural gaps Exists
label_asym_ids of heme B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00006cuk , Chain A 
Resolution 1.47 Å
Residue indices (Uniprot), coverage 9-123 (36-152), 0.81
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) E30H, S31H, G32H, T33H, A34H, A35H, V103T, M128D, M131E
Insertions None
Deletions M1-T29
Sequence identity to UniProt 0.9268
auth_asym_id A
label_asym_ids of heme B
Available structure PDB