Danish
Uniprot ID:  B4RQ30
  • Protein: Cytochrome
  • Organism: Neisseria gonorrhoeae (strain NCCP11945)
  • Length: 201
  • Sequence:
    • MAFVLAAGAVSASPKADVEKGKQVAATVCAACHAADGNSGIAMYPRLAAQHTAYIYHQTIGIRDGKRTHGSAAVMKPVVMNLSDQDILNVSAFYAKQQPKSGEANPKENPELGAKIYRGGLSDKKVPACMSCHGPSGAGMPGGGSEIQAYPRLGGQHQAYIVEQMNAYKSGQRKNTIMEDIANRMSEEDLKAVANFIQGLR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00008uf3 , Chain A 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 3-189 (13-201), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A12G
Insertions None
Deletions A2-S11
Sequence identity to UniProt 0.9948
auth_asym_id A
label_asym_ids of heme D ,  C
Available structure PDB
PDB ID:  pdb_00008uf3 , Chain B 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 3-189 (13-201), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A12G
Insertions None
Deletions A2-S11
Sequence identity to UniProt 0.9948
auth_asym_id B
label_asym_ids of heme G ,  F
Available structure PDB