- Protein: Cytochrome b559 subunit alpha
- Organism:
- Length: 80
- Sequence:
MAGVTGERPFGDIVTSVRYWIIHSITIPALFIAGWLFVSTGLAYDAFGTPRPNEYYPSNQMELPIVDDRYNPDRTLKYQD
| Residue indices (Uniprot), coverage | 18-58 (1-80), 1.00 |
|---|---|
| auth_asym_id | E |
| label_asym_ids of heme | MB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 20-72 (1-80), 1.00 |
|---|---|
| auth_asym_id | E |
| Structural gaps | Exists |
| label_asym_ids of heme | MC |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.16 Å |
| Residue indices (Uniprot), coverage | 20-72 (1-80), 1.00 |
|---|---|
| auth_asym_id | e |
| Structural gaps | Exists |
| label_asym_ids of heme | AF |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.15 Å |