- Protein: Cytochrome b559 subunit beta
- Organism:
- Length: 44
- Sequence:
MTNIGREQPISYPIFTIRWLAIHALAIPSVFFLGSIAAMQFIQR
| Residue indices (Uniprot), coverage | 15-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | MB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 15-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | MC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 15-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | AF |
| Available structure | PDB |