Danish
Uniprot ID:  B8J2Z0
  • Protein: Cytochrome c class III
  • Organism: Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
  • Length: 128
  • Sequence:
    • MKKTLALTCMLALLLAVSAWAAPAVPDKPVEVKGSQKTVMFPHAPHEKVECVTCHHLVDGKESYAKCGSSGCHDDLTAKKGEKSLYYVVHAKGELKHTSCLACHSKVVAEKPELKKDLTGCAKSKCHP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002kmy , Chain A 
Residue indices (Uniprot), coverage 2-107 (22-128), 0.84
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) K92R
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00002ksu , Chain A 
Residue indices (Uniprot), coverage 1-107 (22-128), 0.84
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) K92R
Insertions None
Deletions M1-A21
Sequence identity to UniProt 0.9907
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB