- Protein: Flavin-nucleotide-binding protein
- Organism:
- Length: 223
- Sequence:
MTNRTDDEYPEAPSDRTHVKRYHWLARYDQETVKAILDATPLAHVGCMMNGVPFVTPTFFWREGDRVYWHGSSAGRLFKALEHQDICLTVSLLDGLVIARSAYNFNCNFRSVMLLGRAELISDEAVKAEKLRNFVDGLIPGEWERLRPVHAKEIEATAVASLSIAEASCKVRTGPPLDDEEDYAFPSWAGVIPIRYQVLPPEPDPRNLPDVPMPEDILKFRLG
| Resolution | 0.99 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-223 (1-223), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 0.99 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-223 (1-223), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | H |
| Available structure | PDB |