Danish
Uniprot ID:  C1DK98
  • Protein: Flavin-nucleotide-binding protein
  • Organism: Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
  • Length: 223
  • Sequence:
    • MTNRTDDEYPEAPSDRTHVKRYHWLARYDQETVKAILDATPLAHVGCMMNGVPFVTPTFFWREGDRVYWHGSSAGRLFKALEHQDICLTVSLLDGLVIARSAYNFNCNFRSVMLLGRAELISDEAVKAEKLRNFVDGLIPGEWERLRPVHAKEIEATAVASLSIAEASCKVRTGPPLDDEEDYAFPSWAGVIPIRYQVLPPEPDPRNLPDVPMPEDILKFRLG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006rk0 , Chain A 
Resolution 0.99 Å
Residue indices (Uniprot), coverage 10-223 (1-223), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006rk0 , Chain B 
Resolution 0.99 Å
Residue indices (Uniprot), coverage 10-223 (1-223), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB