Danish
Uniprot ID:  C6L8R0
  • Protein: Hemoglobin subunit alpha-A
  • Organism: Emu (Dromaius novaehollandiae)
  • Length: 142
  • Sequence:
    • MVLSAADKTNTKSVFAKIGPHAEEYGAETLERLFTTYPQTKTYFPHFDLHHGSAQVKAHGKKVAAALVEAANHIDDISTALSKLSDLHAQKLRVDPVNFKLLGQCFLVVVAIHHPSLLTPEVHASLDKFLCAVANVLTAKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003wtg , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-138 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003wtg , Chain C 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-138 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB