Danish
Uniprot ID:  D0G7Q3
  • Protein: Flavocytochrome c heme subunit
  • Organism: Chromatium tepidum (Thermochromatium tepidum)
  • Length: 199
  • Sequence:
    • MTPSTKRLMLAVSVLASGLASNAGAEPTAEMLANNCAGCHGTRGNSAGPASPSIAQMDPAVFVEVMEQFKSGEIQSTIMGRIAKGYSTADFQKMAEYFKQQTYQPVKQSFDKALVAKGTKLHDKYCEKCHVESGKPLADQDEYHILAGQWTPYLRYAIEDFRAERRPMEKKMASKLKELLKAEGEDGLDALFAFYASQQ
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00003vrd , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-174 (26-199), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D ,  C
Available structure PDB