Danish
Uniprot ID:  D0VWV2
  • Protein: Hemoglobin alpha-1 chain
  • Organism: American yellow perch (Perca flavescens)
  • Length: 143
  • Sequence:
    • XSLSSKDKDTVKALWGKIADKAEEIGSDALSRMLAVYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGGIVDAVASIDDLNAGLLALSELHAFTLRVDPANFKILSHCILVLLAVKFPKDFTPEVHISYDKFFSALARALAEKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001xq5 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001xq5 , Chain C 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB