Danish
Uniprot ID:  D3U1H8
  • Protein: Hemoglobin subunit alpha
  • Organism: Siberian woolly mammoth (Mammuthus primigenius)
  • Length: 142
  • Sequence:
    • MVLSDNDKTNVKATWSKVGDHASDYVAEALERMFFSFPTTKTYFPHFDLSHGSGQVKGHGKKVGEALTQAVGHLDDLPSALSALSDLHAHKLRVDPVNFKLLSHCLLVTLSSHQPTEFTPEVHASLDKFLSNVSTVLTSKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00003vrg , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003vrg , Chain A-1 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00003vrf , Chain A 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003vrf , Chain A-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00003vre , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003vre , Chain C 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB