Danish
Uniprot ID:  D3U1H9
  • Protein: Hemoglobin subunit beta/delta hybrid
  • Organism: Siberian woolly mammoth (Mammuthus primigenius)
  • Length: 147
  • Sequence:
    • MVNLTAAEKTQVANLWGKVNVKELGGEALSRLLVVYPWTRRFFEHFGDLSTADAVLHNAKVLAHGEKVLTSFGEGLKHLDNLKGTFSDLSELHCDKLHVDPQNFRLLGNVLVIVLARHFGKEFTPDVQAAYEKVVAGVANALAHKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00003vrg , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003vrg , Chain B-1 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00003vrf , Chain B 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003vrf , Chain B-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E-1
Available structure PDB
PDB ID:  pdb_00003vre , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003vre , Chain D 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H
Available structure PDB