Danish
Uniprot ID:  D4ZE39
  • Protein: Soluble cytochrome cA
  • Organism: Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
  • Length: 107
  • Sequence:
    • MLDFAIGTSNMKKLLAMTAVAVLTLSANVSAQEGKAVYDKACHICHSMGVAGAPKAHDAAAWEPRIAQGLDTLVSTVKTGKGAMPPGGMCTDCTDEDYKSAIEYMSK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00006k7c , Chain A 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 1-76 (32-107), 0.71
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A31
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  C
Available structure PDB
PDB ID:  pdb_00006k7c , Chain B 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 1-76 (32-107), 0.71
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A31
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme E ,  C
Available structure PDB
PDB ID:  pdb_00005b6q , Chain A 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 1-76 (32-107), 0.71
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A31
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005b6q , Chain B 
Resolution 1.78 Å
Residue indices (Uniprot), coverage 1-76 (32-107), 0.71
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A31
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB