Danish
Uniprot ID:  D4ZGZ2
  • Protein: Cytochrome c
  • Organism: Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
  • Length: 147
  • Sequence:
    • MTVLALVSSAILSTAVQAGNFKEADDAIHYRQSAFSLMAHNFGDMGAMLKGKKPFDSEIFTMRAENVAALSKLPLEGFIQGSDLGDTEALAKIWTDKSDFDAKMVSLQDNAAALLLASASDDKKLLKQSFMKVAKSCKGCHDVYKKD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00006a3l , Chain A 
Resolution 2.14 Å
Residue indices (Uniprot), coverage 1-129 (19-147), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A18
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006a3l , Chain B 
Resolution 2.14 Å
Residue indices (Uniprot), coverage 1-129 (19-147), 0.88
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A18
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB