Danish
Uniprot ID:  E2DI02
  • Protein: Chlorite dismutase
  • Organism: Azospira oryzae
  • Length: 282
  • Sequence:
    • MTNISIRSFKLSLIATTIGAAIAMASSPVVAQQAMQPMQPMKIERGTILTQPGVFGVFTMFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTIGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00002vxh , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 8-248 (35-282), 0.89
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) Q32G, Q33S, A34H, P40A
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9841
auth_asym_id A
Missing residues 218VAL-230PRO
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002vxh , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 9-248 (35-282), 0.89
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) Q32G, Q33S, A34H, P40A
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9841
auth_asym_id B
Missing residues 218VAL-227TRP
Structural gaps Exists
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00002vxh , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 10-248 (35-282), 0.89
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) Q32G, Q33S, A34H, P40A
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9841
auth_asym_id C
Missing residues 218VAL-228GLY
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002vxh , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 8-248 (35-282), 0.89
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) Q32G, Q33S, A34H, P40A
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9841
auth_asym_id D
Missing residues 218VAL-228GLY
Structural gaps Exists
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00002vxh , Chain E 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 8-248 (35-282), 0.89
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) Q32G, Q33S, A34H, P40A
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9841
auth_asym_id E
Missing residues 218VAL-228GLY
Structural gaps Exists
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00002vxh , Chain F 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 9-248 (35-282), 0.89
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) Q32G, Q33S, A34H, P40A
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9841
auth_asym_id F
Missing residues 218VAL-228GLY
Structural gaps Exists
label_asym_ids of heme U
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å