Danish
Uniprot ID:  E5RWQ1
  • Protein: Beta-globin
  • Organism: Yellow-spotted Amazon river turtle (Podocnemis unifilis)
  • Length: 147
  • Sequence:
    • MSDFTQEERQFIVNLWGRVDVEQIGAEALARLLIVYPWTQRFFSSFGNLSSPSAILHNAKVHAHGKKVLTSFGEAVKNLDQIKQTFAQLSELHSDKLHVDPENFKLLGNILIIVLAAHFGKDFTPASQAAWQKLVSAVAHALALRYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003at5 , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003at5 , Chain B-1 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D-1
Available structure PDB
PDB ID:  pdb_00003at6 , Chain B 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003at6 , Chain B-1 
Resolution 2.35 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D-1
Available structure PDB