Danish
Uniprot ID:  F2Z285
  • Protein: Hemoglobin subunit alpha
  • Organism: European hare (Lepus europaeus)
  • Length: 141
  • Sequence:
    • VLSPADKTNIKTAWEKIGSHGGEYGAEAVERMFLGFPTTKTYFPHFDFTHGSEQIKAHGKKVSEALTKAVGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLANHHPSEFTPAVHASLDKFLANVSTVLTSKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003lqd , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003lqd , Chain C 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB