Danish
Uniprot ID:  G2R8M6
  • Protein: Heme haloperoxidase family profile domain-containing protein
  • Organism: Thielavia terrestris (Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126))
  • Length: 274
  • Sequence:
    • MKLSILLTLASGQLALSSPDWRWWVVILVYQAPSAYANHSPHPKDRRGPCPMLNTLANHGFLPHNGRNITKEITVNALNSALNVNKTLGELLFNFAVTTNPQPNATFFDLDHLSRHNILEHDASLSRADYYFGHDDHTFNQTVFDQTKSYWKTPIIDVQQAANARLARVLTSNATNPTFVLSQIGEAFSFGETAAYILALGDRVSGTVPRQWVEYLFENERLPLELGWRRAKEVISNSDLDQLTNRVINATGALANITRKIKVRDFHAGRFPGE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00009iz8 , Chain A 
Resolution 1.54 Å
Residue indices (Uniprot), coverage 2-218 (45-250), 0.79
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) M1G, K2F, L3D, N38W, S40P, H42A, K44G
Insertions None
Deletions I5-A37, T251-E274
Sequence identity to UniProt 0.9677
auth_asym_id A
label_asym_ids of heme B
Available structure PDB