Danish
Uniprot ID:  K7N5M5
  • Protein: Hemoglobin subunit alpha 1
  • Organism: Patagonian blennie (Eleginops maclovinus)
  • Length: 142
  • Sequence:
    • SLSDKDKAAVKLLWSKISKSSDAIGNDALSRMIVVYPQTKTYFAHWPDLSPGSPHVKAHGKTVMGGIALAVSKIDDLRAGLLDLSEQHAYKLRVDPANFKILSHCILVVISMMFPKEFTPEAHVSLDKFLSGVSLALSERYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00004esa , Chain A 
Resolution 1.45 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00004esa , Chain C 
Resolution 1.45 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00006rp5 , Chain A 
Resolution 1.49 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Difference from Uniprot sequence acetylation
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00006rp5 , Chain A-1 
Resolution 1.49 Å
Residue indices (Uniprot), coverage 1-142 (1-142), 1.00
Difference from Uniprot sequence acetylation
Mutations (UniProt numbering) None
Insertions 0insX
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D-1
Available structure PDB