- Protein: Hemoglobin subunit alpha 1
- Organism: Patagonian blennie (Eleginops maclovinus)
- Length: 142
- Sequence:
SLSDKDKAAVKLLWSKISKSSDAIGNDALSRMIVVYPQTKTYFAHWPDLSPGSPHVKAHGKTVMGGIALAVSKIDDLRAGLLDLSEQHAYKLRVDPANFKILSHCILVVISMMFPKEFTPEAHVSLDKFLSGVSLALSERYR
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (1-142), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.45 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (1-142), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 1.49 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (1-142), 1.00 |
| Difference from Uniprot sequence | acetylation |
| auth_asym_id | A |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.49 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (1-142), 1.00 |
| Difference from Uniprot sequence | acetylation |
| auth_asym_id | A |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |