Danish
Uniprot ID:  O14521
  • Protein: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
  • Organism: Human (Homo sapiens)
  • Length: 159
  • Sequence:
    • MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00009kc4 , Chain D 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 59-159 (1-159), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00008gs8 , Chain D 
Residue indices (Uniprot), coverage 59-159 (1-159), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme J
Available structure PDB