Danish
Uniprot ID:  O24520
  • Protein: Anaerobic nitrite reductase AHB1
  • Organism: Mouse-ear cress (Arabidopsis thaliana)
  • Length: 160
  • Sequence:
    • MESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEMKVAWGQAYDHLVAAIKAEMNLSN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003zhw , Chain A 
Resolution 2.22 Å
Residue indices (Uniprot), coverage 6-159 (1-160), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003zhw , Chain B 
Resolution 2.22 Å
Residue indices (Uniprot), coverage 8-160 (1-160), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB