Danish
Uniprot ID:  O24782
  • Protein: Cytochrome P450
  • Organism: Pseudomonas paucimobilis (Sphingomonas paucimobilis)
  • Length: 415
  • Sequence:
    • MPKTPHTKGPDETLSLLADPYRFISRQCQRLGANAFESRFLLKKTNCLKGAKAAEIFYDTTRFEREGAMPVAIQKTLLGQGGVQGLDGETHRHRKQMFMGLMTPERVRALAQLFEAEWRRAVPGWTRKGEIVFYDELHEPLTRAVCAWAGVPLPDDEAGNRAGELRALFDAAGSASPRHLWSRLARRRVDAWAKRIIEGIRAGSIGSGSGTAAYAIAWHRDRHDDLLSPHVAAVELVNVLRPTVAIAVYITFVAHALQTCSGIRAALVQQPDYAELFVQEVRRFYPFFPAVVARASQDFEWEGMAFPEGRQVVLDLYGSNHDAATWADPQEFRPERFRAWDEDSFNFIPQGGGDHYLGHRCPGEWIVLAIMKVAAHLLVNAMRYDVPDQDLSIDFARLPALPKSGFVMRNVHIGG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  7
PDB ID:  pdb_00003awm , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 9-415 (1-415), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003awp , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 9-415 (1-415), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F288G
Insertions None
Deletions None
Sequence identity to UniProt 0.9976
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003awq , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 9-415 (1-415), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) L78F
Insertions None
Deletions None
Sequence identity to UniProt 0.9976
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003vm4 , Chain A 
Resolution 1.94 Å
Residue indices (Uniprot), coverage 9-415 (9-415), 0.98
Mutations (UniProt numbering) None
Insertions None
Deletions M1-K8
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003vno , Chain A 
Resolution 2.17 Å
Residue indices (Uniprot), coverage 9-415 (9-415), 0.98
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) R241E
Insertions None
Deletions M1-K8
Sequence identity to UniProt 0.9975
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003voo , Chain A 
Resolution 2.34 Å
Residue indices (Uniprot), coverage 9-415 (9-415), 0.98
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A245E
Insertions None
Deletions M1-K8
Sequence identity to UniProt 0.9975
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003vtj , Chain A 
Resolution 2.56 Å
Residue indices (Uniprot), coverage 9-415 (1-415), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A245H
Insertions None
Deletions None
Sequence identity to UniProt 0.9976
auth_asym_id A
label_asym_ids of heme B
Available structure PDB