Danish
Uniprot ID:  O30881
  • Protein: Cytochrome c6
  • Organism: Agmenellum quadruplicatum (Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6))
  • Length: 117
  • Sequence:
    • MKKLLAIALTVLATVFAFGTPAFAADAAAGAQVFAANCAACHAGGNNAVMPTKTLKADALKTYLAGYKDGSKSLEEAVAYQVTNGQGAMPAFGGRLSDADIANVAAYIADQAENNKW
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  5
PDB ID:  pdb_00004eic , Chain A 
Resolution 0.84 Å
Residue indices (Uniprot), coverage 1-93 (25-117), 0.79
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004eid , Chain A 
Resolution 1.13 Å
Residue indices (Uniprot), coverage 1-93 (25-117), 0.79
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Q81V
Insertions None
Deletions M1-A24
Sequence identity to UniProt 0.9892
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003dr0 , Chain A 
Resolution 1.23 Å
Residue indices (Uniprot), coverage 1-93 (25-117), 0.79
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003dr0 , Chain B 
Resolution 1.23 Å
Residue indices (Uniprot), coverage 1-93 (25-117), 0.79
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003dr0 , Chain C 
Resolution 1.23 Å
Residue indices (Uniprot), coverage 1-93 (25-117), 0.79
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H
Available structure PDB