Danish
Uniprot ID:  O31607
  • Protein: Group 2 truncated hemoglobin YjbI
  • Organism: Bacillus subtilis (strain 168)
  • Length: 132
  • Sequence:
    • MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRSS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00001ux8 , Chain A 
Resolution 2.15 Å
Residue indices (Uniprot), coverage 6-123 (1-132), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB