Danish
Uniprot ID:  O33731
  • Protein: Tetraheme c-type cytochrome
  • Organism: Shewanella frigidimarina (strain NCIMB 400)
  • Length: 111
  • Sequence:
    • MSNKLLSALFAAGFAVMMMSSASFAADETLAEFHVEMGGCENCHADGEPSKDGAYEFEQCQSCHGSLAEMDDNHKPHDGLLMCADCHAPHEAKVGEKPTCDTCHDDGRTAK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  1
PDB ID:  pdb_00002k3v , Chain A 
Residue indices (Uniprot), coverage 1-86 (26-111), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB