Danish
Uniprot ID:  O43169
  • Protein: Cytochrome b5 type B
  • Organism: Human (Homo sapiens)
  • Length: 150
  • Sequence:
    • MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003ner , Chain A 
Resolution 1.45 Å
Residue indices (Uniprot), coverage -3-86 (16-107), 0.61
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G15, S108-S150
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003ner , Chain B 
Resolution 1.45 Å
Residue indices (Uniprot), coverage -4-86 (16-107), 0.61
Mutations (UniProt numbering) None
Insertions None
Deletions M1-G15, S108-S150
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB