Danish
Uniprot ID:  O48782
  • Protein: Heme oxygenase 1, chloroplastic
  • Organism: Mouse-ear cress (Arabidopsis thaliana)
  • Length: 282
  • Sequence:
    • MAYLAPISSSLSIFKNPQLSRFQFSSSSPNPLFLRPRIQILSMTMNKSPSLVVVAATTAAEKQKKRYPGESKGFVEEMRFVAMRLHTKDQAKEGEKETKSIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTYAEFKNTGLERAEKLSTDLEWFKEQGYEIPEPTAPGKTYSQYLKELAEKDPQAFICHFYNIYFAHSAGGRMIGRKVAERILDNKELEFYKWDGELSQLLQNVREKLNKVAEEWTREEKNHCLEETEKSFKYSGEILRLILS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00007eqh , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 71-282 (55-282), 0.84
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S48G, P49H, S50H, L51H, V52H, V53H, V54H
Insertions None
Deletions A2-K47
Sequence identity to UniProt 0.9703
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007eqh , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 71-282 (55-282), 0.84
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S48G, P49H, S50H, L51H, V52H, V53H, V54H
Insertions None
Deletions A2-K47
Sequence identity to UniProt 0.9703
auth_asym_id B
label_asym_ids of heme D
Available structure PDB