Danish
Uniprot ID:  O52685
  • Protein: Mono-heme c-type cytochrome ScyA
  • Organism: Pseudomonas putrefaciens (Shewanella putrefaciens)
  • Length: 99
  • Sequence:
    • MKKLLAMTAVAALTMSVNVSAQDAEAIYNKACTVCHSMGVAGAPKSHNTADWEPRLAKGVDNLVKSVKTGLNAMPPGGMCTDCTDEDYKAAIEFMSKAK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001kx2 , Chain A 
Residue indices (Uniprot), coverage -3-78 (22-99), 0.82
Difference from Uniprot sequence cloning artifact
Mutations (UniProt numbering) V19A, S20D, A21L
Insertions None
Deletions M1-N18
Sequence identity to UniProt 0.9630
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001kx7 , Chain A 
Residue indices (Uniprot), coverage -3-78 (22-99), 0.82
Difference from Uniprot sequence cloning artifact
Mutations (UniProt numbering) V19A, S20D, A21L
Insertions None
Deletions M1-N18
Sequence identity to UniProt 0.9630
auth_asym_id A
label_asym_ids of heme B
Available structure PDB