Danish
Uniprot ID:  O66543
  • Protein: Heme O oxygenase
  • Organism: Aquifex aeolicus (strain VF5)
  • Length: 296
  • Sequence:
    • MNTNLKSSPLKTLVLASVVLTYVLMVFGGIVTSTGSGLGCPDWPLCHGQLLPFQLKEQIPTPPAPVVAPTPLQPWIEQTHRILGGITGIVLLATLFYAFKRGTSFVKKALVFIFIALILEALLGMRVVITEAPLLRELLHYVYTSAHLILSVFILSTITITYYYVKFFGERPKEYIPYADALYVATMFQILLGIFVRYVKALEYNQFVYYLHITYAGFLVILSLFIMFKEFNKYSLITFLLMTAQILAGVATVISGFFLPYLFLHIAIGFFIVLWVSYLVAPSVLKTYTEFRGELA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00008aw5 , Chain A 
Residue indices (Uniprot), coverage 10-291 (1-296), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insG, 296insRNSSAWSHPQFEK
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 57LYS-72PRO
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008aw5 , Chain B 
Residue indices (Uniprot), coverage 10-291 (1-296), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insG, 296insRNSSAWSHPQFEK
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 57LYS-72PRO
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008aw5 , Chain C 
Residue indices (Uniprot), coverage 10-291 (1-296), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insG, 296insRNSSAWSHPQFEK
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 57LYS-72PRO
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å