Danish
Uniprot ID:  O67504
  • Protein: Cytochrome c552
  • Organism: Aquifex aeolicus (strain VF5)
  • Length: 104
  • Sequence:
    • MKKLLLAGLAVAGLTFAADGKAIFQQKGCGSCHQANVDTVGPSLKKIAQAYAGKEDQLIKFLKGEAPAIVDPAKEAIMKPQLTMLKGLSDAELKALADFILSHK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  15
PDB ID:  pdb_00002zxy , Chain A 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 1-86 (18-104), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A17
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002zxy , Chain A-1 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 1-86 (18-104), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A17
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B-1
Available structure PDB
PDB ID:  pdb_00003x15 , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-87 (18-104), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A17
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G ,  E
Available structure PDB
PDB ID:  pdb_00003x15 , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-87 (18-104), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A17
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H ,  F
Available structure PDB
PDB ID:  pdb_00003x15 , Chain C 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-87 (18-104), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A17
Sequence identity to UniProt 1.0000
auth_asym_id G
label_asym_ids of heme G ,  E
Available structure PDB
PDB ID:  pdb_00003x15 , Chain D 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-87 (18-104), 0.84
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A17
Sequence identity to UniProt 1.0000
auth_asym_id J
label_asym_ids of heme H ,  F
Available structure PDB
PDB ID:  pdb_00009wyj , Chain A 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 1-96 (70-5), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4D, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAKMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id A
label_asym_ids of heme G ,  N
Available structure PDB
PDB ID:  pdb_00009wyj , Chain B 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 1-96 (21-69), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4D, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAKMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id B
label_asym_ids of heme I ,  R
Available structure PDB
PDB ID:  pdb_00009wyj , Chain C 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 1-96 (21-69), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4D, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAKMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id C
label_asym_ids of heme G ,  K
Available structure PDB
PDB ID:  pdb_00009wyj , Chain D 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 1-96 (21-69), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4D, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAKMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id D
label_asym_ids of heme I ,  L
Available structure PDB
PDB ID:  pdb_00009wyj , Chain E 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 1-96 (21-69), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4D, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAKMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id E
label_asym_ids of heme K ,  N
Available structure PDB
PDB ID:  pdb_00009wyj , Chain F 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 1-96 (70-5), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4D, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAKMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id F
label_asym_ids of heme L ,  R
Available structure PDB
PDB ID:  pdb_00005z25 , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-96 (4-5), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4T, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAIMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id A
label_asym_ids of heme B-2 ,  B
Available structure PDB
PDB ID:  pdb_00005z25 , Chain A-1 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-96 (4-5), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4T, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAIMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id A
label_asym_ids of heme B-1 ,  B
Available structure PDB
PDB ID:  pdb_00005z25 , Chain A-2 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-96 (4-5), 0.66
Difference from Uniprot sequence engineered mutation:linker
Mutations (UniProt numbering) M1P, K2Q, K3L, L4T, L5M, A7K, A10S, V11D, G13E, T15K, F16A, A17L, G20A, K45A
Insertions 0insVDPAKEAIMK, 19insFILRIAKQAQEKQQQDV
Deletions V70-K104
Sequence identity to UniProt 0.7971
auth_asym_id A
label_asym_ids of heme B-2 ,  B-1
Available structure PDB