Danish
Uniprot ID:  O76745
  • Protein: Nitrophorin Cim l NP
  • Organism: Bed bug (Cimex lectularius)
  • Length: 302
  • Sequence:
    • MKLLLSAGAALAFVLGLCAAGSPPAQLSVHTVSWNSGHERAPTNLEELLGLNSGETPDVIAVAVQGFGFQTDKPQQGPACVKNFQSLLTSKGYTKLKNTITETMGLTVYCLEKHLDQNTLKNETIIVTVDDQKKSGGIVTSFTIYNKRFSFTTSRMSDEDVTSTNTKYAYDTRLDYSKKDDPSDFLFWIGDLNVRVETNATHAKSLVDQNNIDGLMAFDQLKKAKEQKLFDGWTEPQVTFKPTYKFKPNTDEYDLSATPSWTDRALYKSGTGKTIQPLSYNSLTNYKQTEHRPVLAKFRVTL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  9
PDB ID:  pdb_00002imq , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 3-282 (21-302), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id X
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001si6 , Chain A 
Resolution 1.45 Å
Residue indices (Uniprot), coverage 3-282 (21-302), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id X
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004l1y , Chain A 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 3-282 (23-302), 0.93
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A41V
Insertions None
Deletions M1-S22
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001yjh , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 3-282 (21-302), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004l1z , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 3-282 (23-302), 0.93
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F84V
Insertions None
Deletions M1-S22
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004l21 , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 3-282 (23-302), 0.93
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F84V
Insertions None
Deletions M1-S22
Sequence identity to UniProt 0.9964
auth_asym_id A
Missing residues 60CYS-60CYS
Nonstandard amino acids SNC Structure of SNCSNC
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004l20 , Chain A 
Resolution 1.68 Å
Residue indices (Uniprot), coverage 3-282 (23-302), 0.93
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A41V
Insertions None
Deletions M1-S22
Sequence identity to UniProt 0.9964
auth_asym_id A
Missing residues 60CYS-60CYS
Nonstandard amino acids SNC Structure of SNCSNC
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00001y21 , Chain A 
Resolution 1.75 Å
Residue indices (Uniprot), coverage 3-282 (21-302), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme None
Available structure PDB
PDB ID:  pdb_00001ntf , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 3-282 (21-302), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB