Danish
Uniprot ID:  P00003
  • Protein: Cytochrome c
  • Organism: Spider monkey (Ateles sp.)
  • Length: 105
  • Sequence:
    • MGDVEKGKRIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQASGFTYTEANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00005dfs , Chain A 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 1-104 (1-105), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005dfs , Chain B 
Resolution 1.15 Å
Residue indices (Uniprot), coverage 1-104 (1-105), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme H
Available structure PDB