Danish
Uniprot ID:  P00025
  • Protein: Cytochrome c
  • Organism: Skipjack tuna (Katsuwonus pelamis)
  • Length: 104
  • Sequence:
    • MGDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNENTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001cyc , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-103 (2-104), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001cyc , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-103 (2-104), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB