Danish
Uniprot ID:  P00078
  • Protein: Cytochrome c
  • Organism: Crithidia fasciculata
  • Length: 114
  • Sequence:
    • MPPKARAPLPPGDAARGEKLFKGRAAQCHTANQGGANGVGPNLYGLVGRHSGTIEGYAYSKANAESGVVWTPDVLDVYLENPKKFMPGTKMSFAGMKKPQERADVIAYLETLKG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00002yk3 , Chain A 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 5-114 (1-114), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 83LYS-83LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00002yk3 , Chain A-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 5-114 (1-114), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 83LYS-83LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme D-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002yk3 , Chain B 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 5-114 (1-114), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 83LYS-83LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00002yk3 , Chain B-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 5-114 (1-114), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 83LYS-83LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme H-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002yk3 , Chain C 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 5-114 (1-114), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 83LYS-83LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00002yk3 , Chain C-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 5-114 (1-114), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 83LYS-83LYS
Nonstandard amino acids M3L Structure of M3LM3L
label_asym_ids of heme K-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å