- Protein: Cytochrome c4
- Organism:
- Length: 201
- Sequence:
MNKLLVSLLLTLGLTGLAHAAGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDGKRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRGGKIAEGMPACTGCHSPSGVGIATAGFPHLGGQHATYVAKQLTDFREGTRTNDGDTKIMQSIAAKLSNKDIAAISSYIQGLH
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-181 (21-201), 0.90 |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | B , C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.21 Å |
| Residue indices (Uniprot), coverage | 21-201 (21-201), 0.90 |
|---|---|
| auth_asym_id | K |
| label_asym_ids of heme | T , U |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 21-201 (21-201), 0.90 |
|---|---|
| auth_asym_id | N |
| label_asym_ids of heme | BA , CA |
| Available structure | PDB |