Danish
Uniprot ID:  P00106
  • Protein: Cytochrome c4
  • Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
  • Length: 201
  • Sequence:
    • MNKLLVSLLLTLGLTGLAHAAGDAAAGQAKAAVCGACHGADGNSPAPNFPKLAGQGERYLLKQMHDIKDGKRTVLEMTGLLTNLSDQDLADIAAYFASQKMSVGMADPNLVAQGEALFRGGKIAEGMPACTGCHSPSGVGIATAGFPHLGGQHATYVAKQLTDFREGTRTNDGDTKIMQSIAAKLSNKDIAAISSYIQGLH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  5
PDB ID:  pdb_00006q2u , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-181 (21-201), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 116PRO-125GLY
Structural gaps Exists
label_asym_ids of heme C ,  B
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00008smr , Chain D 
Residue indices (Uniprot), coverage 21-201 (21-201), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id K
label_asym_ids of heme U ,  T
Available structure PDB
PDB ID:  pdb_00008smr , Chain I 
Residue indices (Uniprot), coverage 21-201 (21-201), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id N
label_asym_ids of heme CA ,  BA
Available structure PDB
PDB ID:  pdb_00008snh , Chain E 
Residue indices (Uniprot), coverage 21-201 (21-201), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id K
label_asym_ids of heme Z ,  Y
Available structure PDB
PDB ID:  pdb_00008snh , Chain J 
Residue indices (Uniprot), coverage 21-201 (21-201), 0.90
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A20
Sequence identity to UniProt 1.0000
auth_asym_id N
label_asym_ids of heme HA ,  GA
Available structure PDB