Danish
Uniprot ID:  P00114
  • Protein: Cytochrome c6
  • Organism: Thermostichus lividus (Parathermosynechococcus lividus)
  • Length: 87
  • Sequence:
    • ADLANGAKVFSGNCAACHMGGGNVVMANKTLKKEALEQFGMNSEDAIIYQVQHGKNAMPAFAGRLTDEQIQDVAAYVLDQAAKGWAG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  6
PDB ID:  pdb_00002v08 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 3-86 (1-85), 0.98
Mutations (UniProt numbering) N5T, G12A, M19A, G22I, V24L, M26N, N28E, Q38K, E44I, D45V, I48T, Y49T, Q52T, H53N, N56A, A57G, A62K, E68D, Q71A, D72A, A82E
Insertions 0insD
Deletions A86-G87
Sequence identity to UniProt 0.7529
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00002v08 , Chain A-1 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 3-86 (1-85), 0.98
Mutations (UniProt numbering) N5T, G12A, M19A, G22I, V24L, M26N, N28E, Q38K, E44I, D45V, I48T, Y49T, Q52T, H53N, N56A, A57G, A62K, E68D, Q71A, D72A, A82E
Insertions 0insD
Deletions A86-G87
Sequence identity to UniProt 0.7529
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00002v08 , Chain A-2 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 3-86 (1-85), 0.98
Mutations (UniProt numbering) N5T, G12A, M19A, G22I, V24L, M26N, N28E, Q38K, E44I, D45V, I48T, Y49T, Q52T, H53N, N56A, A57G, A62K, E68D, Q71A, D72A, A82E
Insertions 0insD
Deletions A86-G87
Sequence identity to UniProt 0.7529
auth_asym_id A
label_asym_ids of heme C-2
Available structure PDB
PDB ID:  pdb_00002v08 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 3-86 (1-85), 0.98
Mutations (UniProt numbering) N5T, G12A, M19A, G22I, V24L, M26N, N28E, Q38K, E44I, D45V, I48T, Y49T, Q52T, H53N, N56A, A57G, A62K, E68D, Q71A, D72A, A82E
Insertions 0insD
Deletions A86-G87
Sequence identity to UniProt 0.7529
auth_asym_id B
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00002v08 , Chain B-1 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 3-86 (1-85), 0.98
Mutations (UniProt numbering) N5T, G12A, M19A, G22I, V24L, M26N, N28E, Q38K, E44I, D45V, I48T, Y49T, Q52T, H53N, N56A, A57G, A62K, E68D, Q71A, D72A, A82E
Insertions 0insD
Deletions A86-G87
Sequence identity to UniProt 0.7529
auth_asym_id B
label_asym_ids of heme N-1
Available structure PDB
PDB ID:  pdb_00002v08 , Chain B-2 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 3-86 (1-85), 0.98
Mutations (UniProt numbering) N5T, G12A, M19A, G22I, V24L, M26N, N28E, Q38K, E44I, D45V, I48T, Y49T, Q52T, H53N, N56A, A57G, A62K, E68D, Q71A, D72A, A82E
Insertions 0insD
Deletions A86-G87
Sequence identity to UniProt 0.7529
auth_asym_id B
label_asym_ids of heme N-2
Available structure PDB