Danish
Uniprot ID:  P00133
  • Protein: Cytochrome c3
  • Organism: Desulfovibrio gigas (Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759))
  • Length: 112
  • Sequence:
    • VDVPADGAKIDFIAGGEKNLTVVFNHSTHKDVKCDDCHHDPGDKQYAGCTTDGCHNILDKADKSVNSWYKVVHDAKGGAKPTCISCHKDKAGDDKELKKKLTGCKGSACHPS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00001wad , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-111 (1-112), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB
PDB ID:  pdb_00001qn0 , Chain A 
Residue indices (Uniprot), coverage 1-112 (1-112), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D40Q
Insertions None
Deletions None
Sequence identity to UniProt 0.9911
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB
PDB ID:  pdb_00001qn1 , Chain A 
Residue indices (Uniprot), coverage 1-112 (1-112), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D40Q
Insertions None
Deletions None
Sequence identity to UniProt 0.9911
auth_asym_id A
label_asym_ids of heme E ,  D ,  C ,  B
Available structure PDB