Danish

Uniprot ID: P00137

Protein: Cytochrome c3
Organism: Chloropseudomonas ethylica (Desulfuromonas acetoxidans)
Length: 68
Sequence:

ADVVTYENKKGNVTFDHKAHAEKLGCDACHEGTPAKIAIDKKSAHKDACKTCHKSNNGPTKCGGCHIK

Number of chains: 7

PDB ID: 1hh5 , Chain A
Resolution	1.90 Å
Residue indices (Uniprot), coverage	1-68 (1-68), 1.00
auth_asym_id	A
label_asym_ids of heme	B , C , D
Available structure	PDB

PDB ID: 1ehj , Chain A
Residue indices (Uniprot), coverage	1-68 (1-68), 1.00
auth_asym_id	A
label_asym_ids of heme	B , C , D
Available structure	PDB

PDB ID: 1f22 , Chain A
Residue indices (Uniprot), coverage	1-68 (1-68), 1.00
auth_asym_id	A
label_asym_ids of heme	B , C , D
Available structure	PDB

PDB ID: 1kwj , Chain A
Residue indices (Uniprot), coverage	1-68 (1-68), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D
Available structure	PDB

PDB ID: 1l3o , Chain A
Residue indices (Uniprot), coverage	1-68 (1-68), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B , C , D
Available structure	PDB

PDB ID: 1lm2 , Chain A
Residue indices (Uniprot), coverage	1-68 (1-68), 1.00
auth_asym_id	A
label_asym_ids of heme	C , D , E
Available structure	PDB

PDB ID: 1new , Chain A
Residue indices (Uniprot), coverage	1-68 (1-68), 1.00
auth_asym_id	A
label_asym_ids of heme	B , C , D
Available structure	PDB