Danish
Uniprot ID:  P00169
  • Protein: Cytochrome b5
  • Organism: Rabbit (Oryctolagus cuniculus)
  • Length: 134
  • Sequence:
    • MAAQSDKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPDDRSKLSKPMETLITTVDSNSSWWTNWVIPAISALIVALMYRLYMADD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001do9 , Chain A 
Residue indices (Uniprot), coverage 1-94 (6-99), 0.70
Mutations (UniProt numbering) None
Insertions None
Deletions M1-S5, I100-D134
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002m33 , Chain A 
Residue indices (Uniprot), coverage 1-104 (1-134), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB