Danish
Uniprot ID:  P00191
  • Protein: Steroid 21-hydroxylase
  • Organism: Bovine (Bos taurus)
  • Length: 496
  • Sequence:
    • MVLAGLLLLLTLLAGAHLLWGRWKLRNLHLPPLVPGFLHLLQPNLPIHLLSLTQKLGPVYRLRLGLQEVVVLNSKRTIEEAMIRKWVDFAGRPQIPSYKLVSQRCQDISLGDYSLLWKAHKKLTRSALLLGTRSSMEPWVDQLTQEFCERMRVQAGAPVTIQKEFSLLTCSIICYLTFGNKEDTLVHAFHDCVQDLMKTWDHWSIQILDMVPFLRFFPNPGLWRLKQAIENRDHMVEKQLTRHKESMVAGQWRDMTDYMLQGVGRQRVEEGPGQLLEGHVHMSVVDLFIGGTETTASTLSWAVAFLLHHPEIQRRLQEELDRELGPGASCSRVTYKDRARLPLLNATIAEVLRLRPVVPLALPHRTTRPSSIFGYDIPEGMVVIPNLQGAHLDETVWEQPHEFRPDRFLEPGANPSALAFGCGARVCLGESLARLELFVVLLRLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRLQPRGVEAGAWESASAQ
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003qz1 , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 29-483 (1-496), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T241R, L442A
Insertions None
Deletions None
Sequence identity to UniProt 0.9960
auth_asym_id A
Missing residues 131GLY-132THR:269GLU-273GLY:410GLU-412GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.21 Å
PDB ID:  pdb_00003qz1 , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 29-483 (1-496), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T241R, L442A
Insertions None
Deletions None
Sequence identity to UniProt 0.9960
auth_asym_id B
Missing residues 131GLY-134SER:264GLY-273GLY:327GLY-331SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.20 Å
PDB ID:  pdb_00003qz1 , Chain C 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 29-482 (1-496), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T241R, L442A
Insertions None
Deletions None
Sequence identity to UniProt 0.9960
auth_asym_id C
Missing residues 131GLY-132THR:264GLY-273GLY:327GLY-331SER
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.23 Å
PDB ID:  pdb_00003qz1 , Chain D 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 29-481 (1-496), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) T241R, L442A
Insertions None
Deletions None
Sequence identity to UniProt 0.9960
auth_asym_id D
Missing residues 131GLY-133ARG:264GLY-273GLY:327GLY-332ARG
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.23 Å