Danish
Uniprot ID:  P01947
  • Protein: Hemoglobin subunit alpha
  • Organism: Guinea pig (Cavia porcellus)
  • Length: 142
  • Sequence:
    • MVLSAADKNNVKTTWDKIGGHAAEYVAEGLTRMFTSFPTTKTYFHHIDVSPGSGDIKAHGKKVADALTTAVGHLDDLPTALSTLSDVHAHKLRVDPVNFKFLNHCLLVTLAAHLGADFTPSIHASLDKFFASVSTVLTSKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003hyu , Chain A 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003hyu , Chain A-1 
Resolution 1.67 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00003a0g , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-139 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003a0g , Chain A-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-139 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB