Danish
Uniprot ID:  P01959
  • Protein: Hemoglobin subunit alpha
  • Organism: Donkey (Equus asinus)
  • Length: 142
  • Sequence:
    • MVLSAADKTNVKAAWSKVGGNAGEFGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSTVSTVLTSKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001s0h , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) T132S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001s0h , Chain A-1 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) T132S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB