Danish
Uniprot ID:  P01968
  • Protein: Hemoglobin subunit alpha-2
  • Organism: Wild yak (Bos grunniens)
  • Length: 141
  • Sequence:
    • VLSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGAKVAAALTKAVGHLDDLPGALSELSDLHAHKLRVDPVNFKLLSHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTSKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00009jyu , Chain A 
Resolution 1.48 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  E
Available structure PDB
PDB ID:  pdb_00009jyu , Chain A 
Resolution 1.48 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  E
Available structure PDB
PDB ID:  pdb_00009jyu , Chain C 
Resolution 1.48 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I ,  I
Available structure PDB
PDB ID:  pdb_00009jyu , Chain C 
Resolution 1.48 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I ,  I
Available structure PDB