Danish
Uniprot ID:  P01986
  • Protein: Hemoglobin subunit alpha-A
  • Organism: Mallard (Anas platyrhynchos)
  • Length: 142
  • Sequence:
    • MVLSAADKTNVKGVFSKIGGHAEEYGAETLERMFIAYPQTKTYFPHFDLSHGSAQIKAHGKKVAAALVEAVNHVDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVVAIHHPAALTPEVHASLDKFMCAVGAVLTAKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00003eok , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003eok , Chain A-1 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB