Danish
Uniprot ID:  P01989
  • Protein: Hemoglobin subunit alpha-A
  • Organism: Western greylag goose (Anser anser anser)
  • Length: 142
  • Sequence:
    • MVLSAADKTNVKGVFSKIGGHAEEYGAETLERMFTAYPQTKTYFPHFDLQHGSAQIKAHGKKVAAALVEAVNHIDDIAGALSKLSDLHAQKLRVDPVNFKFLGHCFLVVVAIHHPSALTPEVHASLDKFLCAVGTVLTAKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00001faw , Chain A 
Resolution 3.09 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001faw , Chain C 
Resolution 3.09 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB