Danish
Uniprot ID:  P01994
  • Protein: Hemoglobin subunit alpha-A
  • Organism: Chicken (Gallus gallus)
  • Length: 142
  • Sequence:
    • MVLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTYFPHFDLSHGSAQIKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPAALTPEVHASLDKFLCAVGTVLTAKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00009h0m , Chain A 
Resolution 2.64 Å
Residue indices (Uniprot), coverage 2-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00009h0m , Chain C 
Resolution 2.64 Å
Residue indices (Uniprot), coverage 2-142 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00009h0m , Chain G 
Resolution 2.64 Å
Residue indices (Uniprot), coverage 2-139 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id G
label_asym_ids of heme X
Available structure PDB
PDB ID:  pdb_00009h0m , Chain I 
Resolution 2.64 Å
Residue indices (Uniprot), coverage 2-139 (1-142), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id I
label_asym_ids of heme Z
Available structure PDB