Danish
Uniprot ID:  P02019
  • Protein: Hemoglobin subunit alpha-1
  • Organism: Rainbow trout (Oncorhynchus mykiss)
  • Length: 144
  • Sequence:
    • SLTAKDKSVVKAFWGKISGKADVVGAEALGRDKMLTAYPQTKTYFSHWADLSPGSGPVKKHGGIIMGAIGKAVGLMDDLVGGMSALSDLHAFKLRVDPGNFKILSHNILVTLAIHFPSDFTPEVHIAVDKFLAAVSAALADKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001out , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-142 (1-144), 0.99
Difference from Uniprot sequence deletion
Mutations (UniProt numbering) None
Insertions 0insX
Deletions D32-K33
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001out , Chain A-1 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 1-142 (1-144), 0.99
Difference from Uniprot sequence deletion
Mutations (UniProt numbering) None
Insertions 0insX
Deletions D32-K33
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00001ouu , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-142 (1-144), 0.99
Difference from Uniprot sequence deletion
Mutations (UniProt numbering) None
Insertions 0insX
Deletions D32-K33
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001ouu , Chain C 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-142 (1-144), 0.99
Difference from Uniprot sequence deletion
Mutations (UniProt numbering) None
Insertions 0insX
Deletions D32-K33
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB