Danish
Uniprot ID:  P02057
  • Protein: Hemoglobin subunit beta-1/2
  • Organism: Rabbit (Oryctolagus cuniculus)
  • Length: 147
  • Sequence:
    • MVHLSSEEKSAVTALWGKVNVEEVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLAAFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVANALAHKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  2
PDB ID:  pdb_00002rao , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002rao , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme L
Available structure PDB