Danish
Uniprot ID:  P02091
  • Protein: Hemoglobin subunit beta-1
  • Organism: Rat (Rattus norvegicus)
  • Length: 147
  • Sequence:
    • MVHLTDAEKAAVNGLWGKVNPDDVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKEFTPCAQAAFQKVVAGVASALAHKYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00003hf4 , Chain B 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-145 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003hf4 , Chain D 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003dht , Chain B 
Resolution 2.98 Å
Residue indices (Uniprot), coverage 1-145 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003dht , Chain B-1 
Resolution 2.98 Å
Residue indices (Uniprot), coverage 1-145 (2-147), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D-1
Available structure PDB